(data stored in ACNUC7421 zone)

EMBL: CP002160.PE369

CP002160.PE369       Location/Qualifiers
FT   CDS             486309..486623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50160"
FT                   /db_xref="GOA:D9SQ93"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ93"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0333"
FT                   /protein_id="ADL50160.1"
FT                   /translation="MITKQKSIESKDIKKVVYLAIFATLIMIITNIVSYNYLPDYISVK
FT                   SDGSSTIRKEVYVIIFPCISIITNFINLKLNNRSIVNSIFLNIILPLVNIYIIFTSIPR
FT                   "
     MITKQKSIES KDIKKVVYLA IFATLIMIIT NIVSYNYLPD YISVKSDGSS TIRKEVYVII        60
     FPCISIITNF INLKLNNRSI VNSIFLNIIL PLVNIYIIFT SIPR                        104
//

If you have problems or comments...

PBIL Back to PBIL home page