(data stored in ACNUC7421 zone)

EMBL: CP002160.PE37

CP002160.PE37        Location/Qualifiers
FT   CDS             74507..75466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0039"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gym:GYMC10_5613
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49828"
FT                   /db_xref="GOA:D9SMP3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL49828.1"
FT                   /translation="MENTTVKDEELKFSKKKKIGLKNLIEQKYLIFMSLPFVIWAIIFK
FT                   YVPLWGWTMAFQDYKPAKAFSEQTWVGFKHFKAFITDPEFPKLMRNTLGMSILGIIFGF
FT                   VVPIIFALLLNELRGNKFKRTVQSVSYLPHFVSWVVTASIVTTLLAAPSGPINQLLMNL
FT                   HIISKPIQFLSEPKLFWGIVTVSDVWKETGWNAIIYLAAMTGIDPELYDAAKVDGAGRF
FT                   RRMWNITLPSIKPTIMVLLVMSIGSLINIGFEKQFLLKTPMVMDYANVLDLYALNYGIG
FT                   MFRYSFGTAIGIFKSVISIILIFSANKIAEKWGEGKIL"
     MENTTVKDEE LKFSKKKKIG LKNLIEQKYL IFMSLPFVIW AIIFKYVPLW GWTMAFQDYK        60
     PAKAFSEQTW VGFKHFKAFI TDPEFPKLMR NTLGMSILGI IFGFVVPIIF ALLLNELRGN       120
     KFKRTVQSVS YLPHFVSWVV TASIVTTLLA APSGPINQLL MNLHIISKPI QFLSEPKLFW       180
     GIVTVSDVWK ETGWNAIIYL AAMTGIDPEL YDAAKVDGAG RFRRMWNITL PSIKPTIMVL       240
     LVMSIGSLIN IGFEKQFLLK TPMVMDYANV LDLYALNYGI GMFRYSFGTA IGIFKSVISI       300
     ILIFSANKIA EKWGEGKIL                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page