(data stored in ACNUC7421 zone)

EMBL: CP002160.PE370

CP002160.PE370       Location/Qualifiers
FT   CDS             complement(486839..487144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tet:TTHERM_00309880 Ku70/Ku80 beta-barrel
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50161"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ94"
FT                   /inference="similar to AA sequence:KEGG:TTHERM_00309880"
FT                   /protein_id="ADL50161.1"
FT                   /translation="MSYVPNSVYFVDGRLIVNGQRVYGDASSHVDANPSSRITNYGIIT
FT                   YSGRTCVCVEVTNIAVYTWRYINGSGHMEYLTVPLGQFVIDLETGACISGGVLQWY"
     MSYVPNSVYF VDGRLIVNGQ RVYGDASSHV DANPSSRITN YGIITYSGRT CVCVEVTNIA        60
     VYTWRYINGS GHMEYLTVPL GQFVIDLETG ACISGGVLQW Y                           101
//

If you have problems or comments...

PBIL Back to PBIL home page