(data stored in ACNUC7421 zone)

EMBL: CP002160.PE373

CP002160.PE373       Location/Qualifiers
FT   CDS             489999..490565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:541384 myosin binding protein C, fast type
FT                   b"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50164"
FT                   /db_xref="GOA:D9SQ97"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ97"
FT                   /inference="similar to AA sequence:KEGG:541384"
FT                   /protein_id="ADL50164.1"
FT                   /translation="MDERKKNIVIVSVIGFLILIMMIFFCKFSFDKLMNKSERTKKHNP
FT                   NIVNNAVSDANCIIDWRMSDMVVHQLARAQDENVKAMIREGYKEYFNSNSDLLDVESKI
FT                   IKELPKGFGNRRPQSLVSVPITVEHPTSIDQICDIIKKRPSFSINGAENTAETDATAKY
FT                   HQDFIITNNKEGVYTIYMIFYDSGA"
     MDERKKNIVI VSVIGFLILI MMIFFCKFSF DKLMNKSERT KKHNPNIVNN AVSDANCIID        60
     WRMSDMVVHQ LARAQDENVK AMIREGYKEY FNSNSDLLDV ESKIIKELPK GFGNRRPQSL       120
     VSVPITVEHP TSIDQICDII KKRPSFSING AENTAETDAT AKYHQDFIIT NNKEGVYTIY       180
     MIFYDSGA                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page