(data stored in ACNUC7421 zone)

EMBL: CP002160.PE375

CP002160.PE375       Location/Qualifiers
FT   CDS             491352..494966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0386"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: phosphoesterase PHP domain protein; TIGRFAM:
FT                   DNA polymerase III, alpha subunit; KEGG: cac:CAC0516 DNA
FT                   polymerase III DnaE; PFAM: DNA polymerase III alpha
FT                   subunit; PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50166"
FT                   /db_xref="GOA:D9SQ99"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ99"
FT                   /inference="protein motif:TFAM:TIGR00594"
FT                   /protein_id="ADL50166.1"
FT                   /translation="MSRDFVHLHVHTGYSLLDGSGKISLMVKRAKELGMNAMAITDHGV
FT                   MYGCVEFYKAAKEVGIKPILGSEIYVASKSMHIKEQGRKNDTHHLVLLVKNSTGYDNLM
FT                   KIVSAASIDGFYYKPRVDHDFLKKHSEGLIALSACLGGEVQGHILKSNLDIAKETALFY
FT                   KETFKDGFYLELQNHGMREQIMVNEHLIAMSKELDIPLVATNDIHYINKEDSRAHDILL
FT                   CIQTGKTIDEKGRMSYQPEQFYIRSQEEMEELFGYVEEALDNTVKIAEQCNFDYEFHVS
FT                   KLPNFPLPSEQDHFQYLRDTCYKGLAELYEEITEEIKVRLDYELDIIKTMGYVDYFLIV
FT                   WDFIRFANENGIPTGPGRGSAAGSIVAFTLGITKIDPIKYSLLFERFLNPERVSMPDID
FT                   SDFCYERRQEVIDYVVDKYGYESVSQIITFGTMAARMCIRDVGRAMNYSYSEVDAIAKM
FT                   IPNMLGINIERALEVNSELKAAYEENERVRDLIDVSKTLEGLPRHTSTHAAGVVIASQP
FT                   LVSYVPLQKNDEAIVTQYTMGTLEELGLLKMDFLGLRTLTVLKDAVDMVKQNKRIEIDL
FT                   DKIDDADPKVYTMVGEGKTVGVFQLESAGMTSFMKDLKPDSLEDIIAGISLYRPGPMAE
FT                   IPRYIEGKRNPAKIRYETPELEPILGVTYGVMVYQEQVMEIVRKLAGYSMGRSDLVRRA
FT                   MSKKKHKVMEEERQNFIYGIVDKDGNIEVPGCLRNGISVEAANKIFDQMMDFASYAFNK
FT                   SHAAAYAVVAYQTAYMMCYYPTEFIAAMLNSVMGNNEKVAYYIRFAKEKDIEVLPPHIN
FT                   ESYSKFTVNKEKIRFGMASIKNVGGNVTDSIVKVREEKGKFKDFMDFAEKIDVSTVNKR
FT                   AAESLIKSGAFDEFGVYRSQLLAIMEKVLDGVSSQKKRNIQGQLNLFQDFENDDSTMDI
FT                   KIEYPKIKEFEKKYILAMEKEMTGLYLSGHPLDEYVQTLNYVTNTNSSEIVSNQLLEGE
FT                   EQLDNTKIRDGDKVIIGGTIAEISKKITRNNAMMAFLRLEDLYGSVEVIIFPKTYEKVK
FT                   TMLDDDALVIVSGRISIREEEAPKVLCEKIEPLIKNSEEKLKAIFDHSKDRTKGYDSTN
FT                   NRSNLKNFERSKPQISSTLVDNGRKIYIQVTDEDGQKEAIDFLRSLPKDYRGNTRIVLF
FT                   RKSDRVALNVSYELWVNEDTDIVKLLKEKFKEENVKEK"
     MSRDFVHLHV HTGYSLLDGS GKISLMVKRA KELGMNAMAI TDHGVMYGCV EFYKAAKEVG        60
     IKPILGSEIY VASKSMHIKE QGRKNDTHHL VLLVKNSTGY DNLMKIVSAA SIDGFYYKPR       120
     VDHDFLKKHS EGLIALSACL GGEVQGHILK SNLDIAKETA LFYKETFKDG FYLELQNHGM       180
     REQIMVNEHL IAMSKELDIP LVATNDIHYI NKEDSRAHDI LLCIQTGKTI DEKGRMSYQP       240
     EQFYIRSQEE MEELFGYVEE ALDNTVKIAE QCNFDYEFHV SKLPNFPLPS EQDHFQYLRD       300
     TCYKGLAELY EEITEEIKVR LDYELDIIKT MGYVDYFLIV WDFIRFANEN GIPTGPGRGS       360
     AAGSIVAFTL GITKIDPIKY SLLFERFLNP ERVSMPDIDS DFCYERRQEV IDYVVDKYGY       420
     ESVSQIITFG TMAARMCIRD VGRAMNYSYS EVDAIAKMIP NMLGINIERA LEVNSELKAA       480
     YEENERVRDL IDVSKTLEGL PRHTSTHAAG VVIASQPLVS YVPLQKNDEA IVTQYTMGTL       540
     EELGLLKMDF LGLRTLTVLK DAVDMVKQNK RIEIDLDKID DADPKVYTMV GEGKTVGVFQ       600
     LESAGMTSFM KDLKPDSLED IIAGISLYRP GPMAEIPRYI EGKRNPAKIR YETPELEPIL       660
     GVTYGVMVYQ EQVMEIVRKL AGYSMGRSDL VRRAMSKKKH KVMEEERQNF IYGIVDKDGN       720
     IEVPGCLRNG ISVEAANKIF DQMMDFASYA FNKSHAAAYA VVAYQTAYMM CYYPTEFIAA       780
     MLNSVMGNNE KVAYYIRFAK EKDIEVLPPH INESYSKFTV NKEKIRFGMA SIKNVGGNVT       840
     DSIVKVREEK GKFKDFMDFA EKIDVSTVNK RAAESLIKSG AFDEFGVYRS QLLAIMEKVL       900
     DGVSSQKKRN IQGQLNLFQD FENDDSTMDI KIEYPKIKEF EKKYILAMEK EMTGLYLSGH       960
     PLDEYVQTLN YVTNTNSSEI VSNQLLEGEE QLDNTKIRDG DKVIIGGTIA EISKKITRNN      1020
     AMMAFLRLED LYGSVEVIIF PKTYEKVKTM LDDDALVIVS GRISIREEEA PKVLCEKIEP      1080
     LIKNSEEKLK AIFDHSKDRT KGYDSTNNRS NLKNFERSKP QISSTLVDNG RKIYIQVTDE      1140
     DGQKEAIDFL RSLPKDYRGN TRIVLFRKSD RVALNVSYEL WVNEDTDIVK LLKEKFKEEN      1200
     VKEK                                                                   1204
//

If you have problems or comments...

PBIL Back to PBIL home page