(data stored in ACNUC7421 zone)

EMBL: CP002160.PE377

CP002160.PE377       Location/Qualifiers
FT   CDS             496405..497364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0388"
FT                   /product="6-phosphofructokinase"
FT                   /note="KEGG: ctc:CTC02490 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50168"
FT                   /db_xref="GOA:D9SQA1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA1"
FT                   /inference="protein motif:TFAM:TIGR02482"
FT                   /protein_id="ADL50168.1"
FT                   /translation="MKTIGVLTSGGDSPGMNAAIRAVVRTALQNNIRVVGIQRGYSGLI
FT                   NGEITELTRDSVSDIIQRGGTILKTARSNTFRTEEGRRRAADVLKVFGVEGLVVVGGDG
FT                   SFMGAKLLSDLGVATIGLPGTIDNDLAYTDYTIGFDTALNTVIDAVNKLKDTSSSHERA
FT                   SVVEVMGRNCGDIALYSGLAGGAESIILPEKPFDMDELCRGILEGKMRGKLHNLIMVAE
FT                   GVGKAEEIAKKIEDITGIEARVTKLGHIQRGGSPTVADRVLATRMGYRAVELLREGKSA
FT                   RVVGIKNNKIIDLDITEALAIESKFDEDLFKIAETISY"
     MKTIGVLTSG GDSPGMNAAI RAVVRTALQN NIRVVGIQRG YSGLINGEIT ELTRDSVSDI        60
     IQRGGTILKT ARSNTFRTEE GRRRAADVLK VFGVEGLVVV GGDGSFMGAK LLSDLGVATI       120
     GLPGTIDNDL AYTDYTIGFD TALNTVIDAV NKLKDTSSSH ERASVVEVMG RNCGDIALYS       180
     GLAGGAESII LPEKPFDMDE LCRGILEGKM RGKLHNLIMV AEGVGKAEEI AKKIEDITGI       240
     EARVTKLGHI QRGGSPTVAD RVLATRMGYR AVELLREGKS ARVVGIKNNK IIDLDITEAL       300
     AIESKFDEDL FKIAETISY                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page