(data stored in ACNUC7421 zone)

EMBL: CP002160.PE379

CP002160.PE379       Location/Qualifiers
FT   CDS             499695..500066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0390"
FT                   /product="protein of unknown function DUF1540"
FT                   /note="PFAM: protein of unknown function DUF1540; KEGG:
FT                   cac:CAC0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50170"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA3"
FT                   /inference="protein motif:PFAM:PF07561"
FT                   /protein_id="ADL50170.1"
FT                   /translation="MADVNCAAWTCVNNIDGLCSARTINVLGNSAIKPMETQCETFAPR
FT                   EFINAIKNSTNLNLGGALAQMMQAGKDYGVRMTPSINCDAENCVYNELGMCNAKAIAIS
FT                   GDDPMTSKNTQCATFTSTW"
     MADVNCAAWT CVNNIDGLCS ARTINVLGNS AIKPMETQCE TFAPREFINA IKNSTNLNLG        60
     GALAQMMQAG KDYGVRMTPS INCDAENCVY NELGMCNAKA IAISGDDPMT SKNTQCATFT       120
     STW                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page