(data stored in ACNUC7421 zone)

EMBL: CP002160.PE38

CP002160.PE38        Location/Qualifiers
FT   CDS             75485..76390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0040"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dth:DICTH_0039
FT                   transmembrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49829"
FT                   /db_xref="GOA:D9SMP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL49829.1"
FT                   /translation="MEAVKAKKKRDIGAFDIFLYVLMILVMIATLYPFLNVLAISLNDS
FT                   MDTIKGSNFIIPREFTFDNYKEIFKYNNLVSAFFMSVLRTAVGTFTAVICTAMLAYVFS
FT                   RRDYAFNRPVVVLFVITMYVSGGMIPEYMLIKNIGLVGKFSVYIIPALISVFNVIVMRS
FT                   FIDGIPISLQESARIDGANDFVIFYKIIMPLCIPVLATISLFVAVGQWNSWFDTYLYSA
FT                   GKAWLSTLQFEMIKIMDNTNATTAISQAQVNSNSVTNAVVSPQSIRMALTITATVPILL
FT                   VYPFVQKYFVAGMTLGAVKS"
     MEAVKAKKKR DIGAFDIFLY VLMILVMIAT LYPFLNVLAI SLNDSMDTIK GSNFIIPREF        60
     TFDNYKEIFK YNNLVSAFFM SVLRTAVGTF TAVICTAMLA YVFSRRDYAF NRPVVVLFVI       120
     TMYVSGGMIP EYMLIKNIGL VGKFSVYIIP ALISVFNVIV MRSFIDGIPI SLQESARIDG       180
     ANDFVIFYKI IMPLCIPVLA TISLFVAVGQ WNSWFDTYLY SAGKAWLSTL QFEMIKIMDN       240
     TNATTAISQA QVNSNSVTNA VVSPQSIRMA LTITATVPIL LVYPFVQKYF VAGMTLGAVK       300
     S                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page