(data stored in ACNUC7421 zone)

EMBL: CP002160.PE381

CP002160.PE381       Location/Qualifiers
FT   CDS             503230..504594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0392"
FT                   /product="fumarate hydratase, class II"
FT                   /note="KEGG: bsu:BSU33040 fumarate hydratase; TIGRFAM:
FT                   fumarate hydratase, class II; PFAM: fumarate lyase;
FT                   Fumarase C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50172"
FT                   /db_xref="GOA:D9SQA5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA5"
FT                   /inference="protein motif:TFAM:TIGR00979"
FT                   /protein_id="ADL50172.1"
FT                   /translation="MDYRIERDSMGEIKVPSDKYWGAQTQRSFENFKVGSEIMPLDQIK
FT                   AIAIVKKAAAIVNHKIGKLDQEKAEAIKAAADEIIEGKLDDNFPLVVWQTGSGTQTNMN
FT                   VNEVIANRANEILGAKIIHPNDHVNMSQSSNDVYPTAMHIAAVMSLEETLIPEINALID
FT                   TFLELEEVNKGIIKTGRTHLQDATPISFSQEISGWRTMLQMSVEMIKNTLPFLKELAIG
FT                   GTAVGTGLNSHKDYASTMALEISKLTGKEFSADNNKFHGLSSKDAMVFAHGALKALAAN
FT                   AMKIANDVRWMAGGPRCGLNEIYIPENEPGSSIMPGKVNPTQCESLTMVSCQVMGNDMT
FT                   IGMAASQGNFELNVFMPVIIYNFLQSVSLLSSGISSFNSKCAVGITVNKEKMKEYVDKS
FT                   LMLATALNPKIGYDNAAKVVKTAFKEGITLKEAAIKLEILTEEEYDQIIKPENMV"
     MDYRIERDSM GEIKVPSDKY WGAQTQRSFE NFKVGSEIMP LDQIKAIAIV KKAAAIVNHK        60
     IGKLDQEKAE AIKAAADEII EGKLDDNFPL VVWQTGSGTQ TNMNVNEVIA NRANEILGAK       120
     IIHPNDHVNM SQSSNDVYPT AMHIAAVMSL EETLIPEINA LIDTFLELEE VNKGIIKTGR       180
     THLQDATPIS FSQEISGWRT MLQMSVEMIK NTLPFLKELA IGGTAVGTGL NSHKDYASTM       240
     ALEISKLTGK EFSADNNKFH GLSSKDAMVF AHGALKALAA NAMKIANDVR WMAGGPRCGL       300
     NEIYIPENEP GSSIMPGKVN PTQCESLTMV SCQVMGNDMT IGMAASQGNF ELNVFMPVII       360
     YNFLQSVSLL SSGISSFNSK CAVGITVNKE KMKEYVDKSL MLATALNPKI GYDNAAKVVK       420
     TAFKEGITLK EAAIKLEILT EEEYDQIIKP ENMV                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page