(data stored in ACNUC7421 zone)

EMBL: CP002160.PE384

CP002160.PE384       Location/Qualifiers
FT   CDS             506959..508377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0395"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="KEGG: cno:NT01CX_1299 23S rRNA
FT                   (uracil-5-)-methyltransferase RumA; TIGRFAM: RNA
FT                   methyltransferase, TrmA family; PFAM:
FT                   (Uracil-5)-methyltransferase; deoxyribonuclease/rho
FT                   motif-related TRAM"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50175"
FT                   /db_xref="GOA:D9SQA8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQA8"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ADL50175.1"
FT                   /translation="MLEFIRIGDEMKREAPVKKNEEYIIDINGMGYEGEGVGKIDNFTV
FT                   FVPGALKGEKVKVLIVKVNKNFGFGKLKEVIEPSKDRVAPACEIYEKCGGCQLQHLSYK
FT                   GQLEFKKSRVQDCIERIGGFDLSEDNIQLHETLGMENPYRYRNKVQLPVGGTVEDVKIG
FT                   FYSQRSHNIIDMESCNIQFEEADTVVDIVKQWMQENKIQPYNEETHTGIVKHIMVRKAF
FT                   NNDELMVVVVTNGKSLPKKEILIKELQDSFNNLVSVVQNVNDKKTNVVLGLDNVTLFGK
FT                   DTISDYIGEFKFNISPLSFFQVNPVQTEVLYNKALEYAGLTGNEVVFDAYCGTGTISLF
FT                   LSKKASKVYGVEIIEAAIENANINAKENKIDNAEFFVGKCEDVIPKLIADGVKADVVVV
FT                   DPPRKGCEKSLLDALVSMSPERIVYVSCDPGTLARDLRILCDMGYDLKEVQPVDMFPET
FT                   GHVESVVLITRKDR"
     MLEFIRIGDE MKREAPVKKN EEYIIDINGM GYEGEGVGKI DNFTVFVPGA LKGEKVKVLI        60
     VKVNKNFGFG KLKEVIEPSK DRVAPACEIY EKCGGCQLQH LSYKGQLEFK KSRVQDCIER       120
     IGGFDLSEDN IQLHETLGME NPYRYRNKVQ LPVGGTVEDV KIGFYSQRSH NIIDMESCNI       180
     QFEEADTVVD IVKQWMQENK IQPYNEETHT GIVKHIMVRK AFNNDELMVV VVTNGKSLPK       240
     KEILIKELQD SFNNLVSVVQ NVNDKKTNVV LGLDNVTLFG KDTISDYIGE FKFNISPLSF       300
     FQVNPVQTEV LYNKALEYAG LTGNEVVFDA YCGTGTISLF LSKKASKVYG VEIIEAAIEN       360
     ANINAKENKI DNAEFFVGKC EDVIPKLIAD GVKADVVVVD PPRKGCEKSL LDALVSMSPE       420
     RIVYVSCDPG TLARDLRILC DMGYDLKEVQ PVDMFPETGH VESVVLITRK DR               472
//

If you have problems or comments...

PBIL Back to PBIL home page