(data stored in ACNUC7421 zone)

EMBL: CP002160.PE39

CP002160.PE39        Location/Qualifiers
FT   CDS             76532..78565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0041"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="KEGG: gym:GYMC10_5609 beta-galactosidase; PFAM:
FT                   Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49830"
FT                   /db_xref="GOA:D9SMP5"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP5"
FT                   /inference="protein motif:PRIAM:3.2.1.23"
FT                   /protein_id="ADL49830.1"
FT                   /translation="MKNLSSIFYGGDYNPDQWPDEIYQEDMRLFKLAGINIITIPVFSW
FT                   ALLQPSEDEYKFEWLDKILDLAWENGISVCLATSTAAQPSWMSKKYPEMLPVDFYGRRR
FT                   KHGGRVNFCPNNEKYHEFSTKLTGLMAERYKNHPAIALWHIGNEYGNYCYCDKCEEEFR
FT                   NWAKKRYGTIENLNKKWYLNFWGHTIYDWDEIVIPSGLSEVWMDGWTAKTNFQSIAIDY
FT                   NRFMSESVFNCYKAEYDIIKNITPEIPITTNLMGTFKPLDYFKWAEYMDIISWDNYPSL
FT                   TDPMFKTAMRHDLMRGLKDGKPFLLMEQTPSQQNWQPYNSVKRPGVLRLQSYQTLAHGA
FT                   DAIMFFQLRQSIGACEKYHGAVISHAGHENTRVFKELTQIGDELKALGDKTIDSRMQAK
FT                   VAIVFDWENWWAVEFSSGPSKDLNYVEQVEKYYEAFYNMNIAVDMVKPEADLSQYKIVV
FT                   APVLYMLRPGVAKNFESYVENGGTFVTTFFSGYVDETDIVKVGGYPGELRKLLGLWVEE
FT                   IDAIFPDMSNSIVMKETVGKLEKEYISKMLCDILNVETAKVLAVYGKDFYAGKPALTVN
FT                   NFGKGKAYYIATDPEQSFIAGLMEVLCEDNSITAPFQAKAGVEIAQRFKDDKEITFIMN
FT                   YNDEDVVINLKDENYIDLIKNKGKKGEILIKSKDVLVLERKI"
     MKNLSSIFYG GDYNPDQWPD EIYQEDMRLF KLAGINIITI PVFSWALLQP SEDEYKFEWL        60
     DKILDLAWEN GISVCLATST AAQPSWMSKK YPEMLPVDFY GRRRKHGGRV NFCPNNEKYH       120
     EFSTKLTGLM AERYKNHPAI ALWHIGNEYG NYCYCDKCEE EFRNWAKKRY GTIENLNKKW       180
     YLNFWGHTIY DWDEIVIPSG LSEVWMDGWT AKTNFQSIAI DYNRFMSESV FNCYKAEYDI       240
     IKNITPEIPI TTNLMGTFKP LDYFKWAEYM DIISWDNYPS LTDPMFKTAM RHDLMRGLKD       300
     GKPFLLMEQT PSQQNWQPYN SVKRPGVLRL QSYQTLAHGA DAIMFFQLRQ SIGACEKYHG       360
     AVISHAGHEN TRVFKELTQI GDELKALGDK TIDSRMQAKV AIVFDWENWW AVEFSSGPSK       420
     DLNYVEQVEK YYEAFYNMNI AVDMVKPEAD LSQYKIVVAP VLYMLRPGVA KNFESYVENG       480
     GTFVTTFFSG YVDETDIVKV GGYPGELRKL LGLWVEEIDA IFPDMSNSIV MKETVGKLEK       540
     EYISKMLCDI LNVETAKVLA VYGKDFYAGK PALTVNNFGK GKAYYIATDP EQSFIAGLME       600
     VLCEDNSITA PFQAKAGVEI AQRFKDDKEI TFIMNYNDED VVINLKDENY IDLIKNKGKK       660
     GEILIKSKDV LVLERKI                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page