(data stored in ACNUC7421 zone)

EMBL: CP002160.PE392

CP002160.PE392       Location/Qualifiers
FT   CDS             517959..518762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0405"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: lbf:LBF_2413 AraC-family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50183"
FT                   /db_xref="GOA:D9SQB6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL50183.1"
FT                   /translation="MATFDQQSIYIKDLPSSLAKMGFQFYQSKNIEDGLVTLPAFTGVR
FT                   INFIFDGKSVASGVLKSGDLMIAGYTDSPLYGNVYNFSMASIGIHFSLFYYLTGLFPRQ
FT                   CRIPYKVPENSRIYSDLVPFFFLPRENWDSHALSIIKKNQLVLNKVVIKQMERVSLATQ
FT                   LYGYNQMKGFQDISNELGISYRQLQRDFHAFLGMTPSQYERLLRYQVAALNIKNTSIIE
FT                   VALSSGYYDQAHMIREFKKFSDKTPRQIAELNDITVPFVDRKIDL"
     MATFDQQSIY IKDLPSSLAK MGFQFYQSKN IEDGLVTLPA FTGVRINFIF DGKSVASGVL        60
     KSGDLMIAGY TDSPLYGNVY NFSMASIGIH FSLFYYLTGL FPRQCRIPYK VPENSRIYSD       120
     LVPFFFLPRE NWDSHALSII KKNQLVLNKV VIKQMERVSL ATQLYGYNQM KGFQDISNEL       180
     GISYRQLQRD FHAFLGMTPS QYERLLRYQV AALNIKNTSI IEVALSSGYY DQAHMIREFK       240
     KFSDKTPRQI AELNDITVPF VDRKIDL                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page