(data stored in ACNUC7421 zone)

EMBL: CP002160.PE393

CP002160.PE393       Location/Qualifiers
FT   CDS             complement(518983..519756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0406"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cpy:Cphy_1168 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50184"
FT                   /db_xref="GOA:D9SQB7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB7"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL50184.1"
FT                   /translation="MFKINYCDYNHSNPDYDQINRPYGSGDYLFLFFLTPMKIKIGEET
FT                   IFSKENAFILFPKGTPQEYSAVKKFKNSFLHFSPQDDFTSQYSIPVNQIVYLPNPEVIN
FT                   DILKQIYIEFSLKNMHYVEKVDSLINQLFIDFSRQLQSIPYDFNKDLNIFEQFNKARVE
FT                   ILTHIEKDWTSKSMASLTNLGTSQFYNYYRYFFSRSPKSELLDARIARAKYLLKVNKLP
FT                   VSQVATLSGFNNLSHFTRYFKKSCGITPLEYSKTL"
     MFKINYCDYN HSNPDYDQIN RPYGSGDYLF LFFLTPMKIK IGEETIFSKE NAFILFPKGT        60
     PQEYSAVKKF KNSFLHFSPQ DDFTSQYSIP VNQIVYLPNP EVINDILKQI YIEFSLKNMH       120
     YVEKVDSLIN QLFIDFSRQL QSIPYDFNKD LNIFEQFNKA RVEILTHIEK DWTSKSMASL       180
     TNLGTSQFYN YYRYFFSRSP KSELLDARIA RAKYLLKVNK LPVSQVATLS GFNNLSHFTR       240
     YFKKSCGITP LEYSKTL                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page