(data stored in ACNUC7421 zone)

EMBL: CP002160.PE394

CP002160.PE394       Location/Qualifiers
FT   CDS             519921..521240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0407"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   csc:Csac_1560 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50185"
FT                   /db_xref="GOA:D9SQB8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB8"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ADL50185.1"
FT                   /translation="MRPGFQLNNHNRDLNTCFESHDPSMMWDPVSKTYYSYCTDTAIVS
FT                   DYRQGIPVRKSKDLINFEFVGRVLSDEAIAQGRDNGEGFDPTFGFWAPYTEYVDGEYRM
FT                   YYSATKAFGSSESRIWLAVASNPEGPFENRGVVMDTWNTSDAEPNAIDAHVCDTADGRK
FT                   YFIYGSFFGGIFIKELDKETGMPINPDKYYQGECIAKKPYNSYIDGPEGAAIIYNPDTE
FT                   YYYMFLSYGWLGDDYDIRVGRCKKITGPYVDYNGESMVGNALGMKLAGSYHFKGSNPYA
FT                   GNDSEGWKFDGFRGPGHGVPFYAPEKDEYFFVHHVRDGAQIFCKKEKDRQSFRMHYMAI
FT                   RKMYFVDGWPLFSPEPYAGEKSTVTKLSDKKEMLELEWEWLLLKADNNTMAESVVSKLP
FT                   DYLIPEKTYVFTAYDYENCRECIVLSGITNVGETVWAKIH"
     MRPGFQLNNH NRDLNTCFES HDPSMMWDPV SKTYYSYCTD TAIVSDYRQG IPVRKSKDLI        60
     NFEFVGRVLS DEAIAQGRDN GEGFDPTFGF WAPYTEYVDG EYRMYYSATK AFGSSESRIW       120
     LAVASNPEGP FENRGVVMDT WNTSDAEPNA IDAHVCDTAD GRKYFIYGSF FGGIFIKELD       180
     KETGMPINPD KYYQGECIAK KPYNSYIDGP EGAAIIYNPD TEYYYMFLSY GWLGDDYDIR       240
     VGRCKKITGP YVDYNGESMV GNALGMKLAG SYHFKGSNPY AGNDSEGWKF DGFRGPGHGV       300
     PFYAPEKDEY FFVHHVRDGA QIFCKKEKDR QSFRMHYMAI RKMYFVDGWP LFSPEPYAGE       360
     KSTVTKLSDK KEMLELEWEW LLLKADNNTM AESVVSKLPD YLIPEKTYVF TAYDYENCRE       420
     CIVLSGITNV GETVWAKIH                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page