(data stored in ACNUC7421 zone)

EMBL: CP002160.PE395

CP002160.PE395       Location/Qualifiers
FT   CDS             521339..522082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_0694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50186"
FT                   /db_xref="GOA:D9SQB9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029478"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQB9"
FT                   /inference="similar to AA sequence:KEGG:Ccel_0694"
FT                   /protein_id="ADL50186.1"
FT                   /translation="MKELYDMIFKRKSFRKFNDALSFSEEELQDINEEIKRLIPLITGI
FT                   EVKYEIVPREKTTCKRGECCLLIYSEEKEHYLLNVGYMFEQLDLYLASRNIGVCWYGMG
FT                   KVNETQYNNLPYVIMLALGKAEENQFRKDYRKSKRKETSDIWKGDLSFEIAEFVKYAPS
FT                   ACNTQPWRVVCENHTLKIYRITEIKSIIPKEKVSFYNSIDMGIFLYFVELALSHNKISF
FT                   QRTLSPENNEADLIPIGIYMLKKEG"
     MKELYDMIFK RKSFRKFNDA LSFSEEELQD INEEIKRLIP LITGIEVKYE IVPREKTTCK        60
     RGECCLLIYS EEKEHYLLNV GYMFEQLDLY LASRNIGVCW YGMGKVNETQ YNNLPYVIML       120
     ALGKAEENQF RKDYRKSKRK ETSDIWKGDL SFEIAEFVKY APSACNTQPW RVVCENHTLK       180
     IYRITEIKSI IPKEKVSFYN SIDMGIFLYF VELALSHNKI SFQRTLSPEN NEADLIPIGI       240
     YMLKKEG                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page