(data stored in ACNUC7421 zone)

EMBL: CP002160.PE396

CP002160.PE396       Location/Qualifiers
FT   CDS             complement(522291..522968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0409"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: ckl:CKL_0487 manganese catalase; PFAM:
FT                   manganese containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50187"
FT                   /db_xref="GOA:D9SQC0"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC0"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADL50187.1"
FT                   /translation="MFKHEKQLLNQLEVKVERPNPQYAVLMQEQLGGGNGELKAAMQYL
FT                   SQSFRIKDQTIKDLFLDIGTEELSHMEIVAETINLLNGHNVDNTSVGSGEIETHVLTGL
FT                   SPVLINSSGEPWTANYVTVTGDLVADLLSNIASEQRAKVVYEYLYRQINDKHVKNTIDF
FT                   LLNREEAHNALFREALNKIKDTGSNMDFGVTEDSRLYFDLSTPGRYFENPNPTAPEFAN
FT                   PRR"
     MFKHEKQLLN QLEVKVERPN PQYAVLMQEQ LGGGNGELKA AMQYLSQSFR IKDQTIKDLF        60
     LDIGTEELSH MEIVAETINL LNGHNVDNTS VGSGEIETHV LTGLSPVLIN SSGEPWTANY       120
     VTVTGDLVAD LLSNIASEQR AKVVYEYLYR QINDKHVKNT IDFLLNREEA HNALFREALN       180
     KIKDTGSNMD FGVTEDSRLY FDLSTPGRYF ENPNPTAPEF ANPRR                       225
//

If you have problems or comments...

PBIL Back to PBIL home page