(data stored in ACNUC7421 zone)

EMBL: CP002160.PE399

CP002160.PE399       Location/Qualifiers
FT   CDS             525635..526315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0412"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cce:Ccel_2324 two component transcriptional
FT                   regulator, winged helix family; PFAM: transcriptional
FT                   regulator domain-containing protein; response regulator
FT                   receiver; SMART: response regulator receiver;
FT                   transcriptional regulator domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50190"
FT                   /db_xref="GOA:D9SQC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC3"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADL50190.1"
FT                   /translation="MNTILLIEDNKDVNRMISEVLFDAGYQVKSAYTGIEGINEIKNSN
FT                   YDLILLDIMLPYKSGDEILKEMRNFSDTPVIVISAKDMVGTKIDILKLGADDYITKPFD
FT                   LGEVLARIEATLRRCHKQVHINKVIKYKDIVLDDNSKHVSVNGVEIELTAKEYMILEML
FT                   IKYQGKVFTKANLYESIWKEEYLGDDNAVKTHVSNLRSKLQKANEHEKYIETVWGLGYR
FT                   LYKE"
     MNTILLIEDN KDVNRMISEV LFDAGYQVKS AYTGIEGINE IKNSNYDLIL LDIMLPYKSG        60
     DEILKEMRNF SDTPVIVISA KDMVGTKIDI LKLGADDYIT KPFDLGEVLA RIEATLRRCH       120
     KQVHINKVIK YKDIVLDDNS KHVSVNGVEI ELTAKEYMIL EMLIKYQGKV FTKANLYESI       180
     WKEEYLGDDN AVKTHVSNLR SKLQKANEHE KYIETVWGLG YRLYKE                      226
//

If you have problems or comments...

PBIL Back to PBIL home page