(data stored in ACNUC7421 zone)

EMBL: CP002160.PE400

CP002160.PE400       Location/Qualifiers
FT   CDS             526482..527405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0413"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cce:Ccel_2323 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50191"
FT                   /db_xref="GOA:D9SQC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50191.1"
FT                   /translation="MKKYILKTHNLSKIYKGSNALKDVSVSLEAGKIYGLIGQNGAGKS
FT                   TLMRVITGLTFPTSGSLELFGHGGEKELQLERKRIGSMIEYPSLSPNMTAMENMRLHRI
FT                   MKGIPDKQVEDELLELVGLLDTGKKKAKDFSLGMKQRLGIAIALIGNPELLILDEPING
FT                   LDPLGVVEIRKLLKKLCEERQMTILISSHNLPELYQTATDYIIIHKGEIKQTLTLEQLE
FT                   ENCKHHLLISCVQPEKLASVLEMKLNTQNYKVMPDKSIKLYDYLDKKELVGRTLFENGI
FT                   IITNLSNEGDTLEDYFISIVGGSKDV"
     MKKYILKTHN LSKIYKGSNA LKDVSVSLEA GKIYGLIGQN GAGKSTLMRV ITGLTFPTSG        60
     SLELFGHGGE KELQLERKRI GSMIEYPSLS PNMTAMENMR LHRIMKGIPD KQVEDELLEL       120
     VGLLDTGKKK AKDFSLGMKQ RLGIAIALIG NPELLILDEP INGLDPLGVV EIRKLLKKLC       180
     EERQMTILIS SHNLPELYQT ATDYIIIHKG EIKQTLTLEQ LEENCKHHLL ISCVQPEKLA       240
     SVLEMKLNTQ NYKVMPDKSI KLYDYLDKKE LVGRTLFENG IIITNLSNEG DTLEDYFISI       300
     VGGSKDV                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page