(data stored in ACNUC7421 zone)

EMBL: CP002160.PE401

CP002160.PE401       Location/Qualifiers
FT   CDS             527398..528195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0414"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: cce:Ccel_2322 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50192"
FT                   /db_xref="GOA:D9SQC5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC5"
FT                   /inference="similar to AA sequence:KEGG:Ccel_2322"
FT                   /protein_id="ADL50192.1"
FT                   /translation="MYNLILADLFKIRKSMTIKVIFAITTISAVAMVMMAYLIQQGSIS
FT                   TSMAGIGFMFSDINVMSILGAVMAGVFICGDFDNKIIHESIANGNSRGTVIVVKIITFL
FT                   CSIVVILIPYIVATVIAFGTGYKFSMGSVSIGFLNLLTVETGKVLSAVEMWKLLVVMLT
FT                   LLLVYLAQMSLCIPLALALKKPVFVVAIYYGATILFAQLVGVKNFSLVIYNIFSCTPYG
FT                   GKHSMVVLNTGTGEIFKTISISLLFISTMFFISYFTFRKSEIK"
     MYNLILADLF KIRKSMTIKV IFAITTISAV AMVMMAYLIQ QGSISTSMAG IGFMFSDINV        60
     MSILGAVMAG VFICGDFDNK IIHESIANGN SRGTVIVVKI ITFLCSIVVI LIPYIVATVI       120
     AFGTGYKFSM GSVSIGFLNL LTVETGKVLS AVEMWKLLVV MLTLLLVYLA QMSLCIPLAL       180
     ALKKPVFVVA IYYGATILFA QLVGVKNFSL VIYNIFSCTP YGGKHSMVVL NTGTGEIFKT       240
     ISISLLFIST MFFISYFTFR KSEIK                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page