(data stored in ACNUC7421 zone)

EMBL: CP002160.PE403

CP002160.PE403       Location/Qualifiers
FT   CDS             529497..530723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0416"
FT                   /product="Domain of unknown function DUF1858"
FT                   /note="PFAM: Domain of unknown function DUF1858; KEGG:
FT                   aoe:Clos_0147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50194"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC7"
FT                   /inference="protein motif:PFAM:PF08984"
FT                   /protein_id="ADL50194.1"
FT                   /translation="MTNKYFDIEDTLFNITENYSEATELLIALGFSNLKDENMRKVFGK
FT                   SISLEAALKLKKINVETFMAELIEKIENNNPGSEELSEKNNTIKIAGVLPCPVKAPLTE
FT                   AFEGWVNNQNFDYKLEYELKAASMGISWLKDALMEQSKEQLPDLFISAGFELFFDKKLF
FT                   GKYKAEDMFEDLTDFEHYNEDFENDYIKLKDPNRQYSIVGVVAAVFLVNVEELSGRKIP
FT                   TSWEDILQEEFENSVSLPIADFDLFNSILLNIYKNYGEDGVRRLGKSLKKSMHPSEMVK
FT                   SHIKKFDKPTITIMPYFFTKMVKEDGPMVPVWPKEGAIVSPIFMLSKKSKKAELKPIVD
FT                   FFASKEIGEILSHNGRFPSVNPEVDNMISKENKYMWLGWDYIKEKDISVEIKKSLDIFN
FT                   SFVEGDKTV"
     MTNKYFDIED TLFNITENYS EATELLIALG FSNLKDENMR KVFGKSISLE AALKLKKINV        60
     ETFMAELIEK IENNNPGSEE LSEKNNTIKI AGVLPCPVKA PLTEAFEGWV NNQNFDYKLE       120
     YELKAASMGI SWLKDALMEQ SKEQLPDLFI SAGFELFFDK KLFGKYKAED MFEDLTDFEH       180
     YNEDFENDYI KLKDPNRQYS IVGVVAAVFL VNVEELSGRK IPTSWEDILQ EEFENSVSLP       240
     IADFDLFNSI LLNIYKNYGE DGVRRLGKSL KKSMHPSEMV KSHIKKFDKP TITIMPYFFT       300
     KMVKEDGPMV PVWPKEGAIV SPIFMLSKKS KKAELKPIVD FFASKEIGEI LSHNGRFPSV       360
     NPEVDNMISK ENKYMWLGWD YIKEKDISVE IKKSLDIFNS FVEGDKTV                    408
//

If you have problems or comments...

PBIL Back to PBIL home page