(data stored in ACNUC7421 zone)

EMBL: CP002160.PE405

CP002160.PE405       Location/Qualifiers
FT   CDS             531414..532430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0418"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: aoe:Clos_0149 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50196"
FT                   /db_xref="GOA:D9SQC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQC9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50196.1"
FT                   /translation="MLKIEELEKEKIKDLEKQYPFILSFFENNKLDVKGYKEYTFQEYL
FT                   KHFTQEEIEEWAIDIEKMKIDLEIFINQMLEFLGVEKDRVDSITIIAGKDKYGNKENFD
FT                   KLTINKSEIISIVGPTGAGKSRLLADIEWAANKDTPTERVILINGEFPDKSLRFSTSNK
FT                   LVAQLSQNMNFIMDLSVKEFIELHARSRMIDNEEEVTNKILEAANELAGEKFNLDTPIT
FT                   GLSGGQSRALMIADTAILSTSPIVLIDEIENAGIDRKRALNLLVSKEKIVLMATHDPSL
FT                   ALMADKRIVIKNGGIYKVIETDREEKSILEELERMDTIISKMRTNLRNGDILEKEKV"
     MLKIEELEKE KIKDLEKQYP FILSFFENNK LDVKGYKEYT FQEYLKHFTQ EEIEEWAIDI        60
     EKMKIDLEIF INQMLEFLGV EKDRVDSITI IAGKDKYGNK ENFDKLTINK SEIISIVGPT       120
     GAGKSRLLAD IEWAANKDTP TERVILINGE FPDKSLRFST SNKLVAQLSQ NMNFIMDLSV       180
     KEFIELHARS RMIDNEEEVT NKILEAANEL AGEKFNLDTP ITGLSGGQSR ALMIADTAIL       240
     STSPIVLIDE IENAGIDRKR ALNLLVSKEK IVLMATHDPS LALMADKRIV IKNGGIYKVI       300
     ETDREEKSIL EELERMDTII SKMRTNLRNG DILEKEKV                               338
//

If you have problems or comments...

PBIL Back to PBIL home page