(data stored in ACNUC7421 zone)

EMBL: CP002160.PE407

CP002160.PE407       Location/Qualifiers
FT   CDS             533401..534471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0420"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II; KEGG: hor:Hore_01750
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50198"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD1"
FT                   /inference="protein motif:PFAM:PF06089"
FT                   /protein_id="ADL50198.1"
FT                   /translation="MEPLVALTRSNRIESIHAGYICITDSNNNVLYNIGDCKDKVFLRS
FT                   AAKPFIATTFIKSGAMEQFDISEKELAIICSSHTGEDYHRETISSILNKIGVSEEDLKC
FT                   GISAPYNKEMNERLIRKNERPSKLYNCCSGKHSGMLAACKALGLPIDSYNDKCHPLQKL
FT                   ILYNISKLLGCSEEDIILGIDGCTVPSFMITIQQISYLYALLADGGNTKEEYKDALTKI
FT                   RNSMVAYPEMIDGYEEFYTELMGHSDKRMIAKVGDEGLYCVAVPEKKIGIVVKIVDGNE
FT                   RACYPVIIEVLKQLGIFTKTESKQLYNWAFTPLKNHVSDVIGYTLPVFNINKNQSNKNI
FT                   TIGQLLEFKGDNLWNN"
     MEPLVALTRS NRIESIHAGY ICITDSNNNV LYNIGDCKDK VFLRSAAKPF IATTFIKSGA        60
     MEQFDISEKE LAIICSSHTG EDYHRETISS ILNKIGVSEE DLKCGISAPY NKEMNERLIR       120
     KNERPSKLYN CCSGKHSGML AACKALGLPI DSYNDKCHPL QKLILYNISK LLGCSEEDII       180
     LGIDGCTVPS FMITIQQISY LYALLADGGN TKEEYKDALT KIRNSMVAYP EMIDGYEEFY       240
     TELMGHSDKR MIAKVGDEGL YCVAVPEKKI GIVVKIVDGN ERACYPVIIE VLKQLGIFTK       300
     TESKQLYNWA FTPLKNHVSD VIGYTLPVFN INKNQSNKNI TIGQLLEFKG DNLWNN           356
//

If you have problems or comments...

PBIL Back to PBIL home page