(data stored in ACNUC7421 zone)

EMBL: CP002160.PE408

CP002160.PE408       Location/Qualifiers
FT   CDS             534459..535502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0421"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II; KEGG: hor:Hore_01750
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50199"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD2"
FT                   /inference="protein motif:PFAM:PF06089"
FT                   /protein_id="ADL50199.1"
FT                   /translation="MEQLAVLTRSGYVESIHYGYICVVDSSGKIIKEIGDSNTKIYFRS
FT                   SAKPIQAVPVIESGASQHFGFTKKEISIMCSSHSGQIMHQDTVTEMLKKIGEEANVLKC
FT                   GIMIPYNKEEANRLQSSKEKPSVLHCSCSAKHVGMLTLAKYKNYSIDDYNRIDHPAQHE
FT                   ILNTISYFTDYNEENITVGIDGCGAPIYIIPIYNIALSYARIMNFANDENSKYHKACKT
FT                   IIESMIEYPEMVAGDEEFCTELMRFTNGKLIGKVGSEAVYCVGIKDKGIGICVKIIDGN
FT                   ERAVYPVVMQILKELNILDKNELNNLQHWSRVELKNNLDEVIGDILPSFQLLNKYKLGD
FT                   KVADTSV"
     MEQLAVLTRS GYVESIHYGY ICVVDSSGKI IKEIGDSNTK IYFRSSAKPI QAVPVIESGA        60
     SQHFGFTKKE ISIMCSSHSG QIMHQDTVTE MLKKIGEEAN VLKCGIMIPY NKEEANRLQS       120
     SKEKPSVLHC SCSAKHVGML TLAKYKNYSI DDYNRIDHPA QHEILNTISY FTDYNEENIT       180
     VGIDGCGAPI YIIPIYNIAL SYARIMNFAN DENSKYHKAC KTIIESMIEY PEMVAGDEEF       240
     CTELMRFTNG KLIGKVGSEA VYCVGIKDKG IGICVKIIDG NERAVYPVVM QILKELNILD       300
     KNELNNLQHW SRVELKNNLD EVIGDILPSF QLLNKYKLGD KVADTSV                     347
//

If you have problems or comments...

PBIL Back to PBIL home page