(data stored in ACNUC7421 zone)

EMBL: CP002160.PE409

CP002160.PE409       Location/Qualifiers
FT   CDS             536136..536549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0423"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpf:BpOF4_22044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50200"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD3"
FT                   /inference="similar to AA sequence:KEGG:BpOF4_22044"
FT                   /protein_id="ADL50200.1"
FT                   /translation="MEKLNVFRDKKGIEKVTLLMILFTISLLMGCNNSISKGKKVDYIE
FT                   VVKLSDNKKWTFLEKDEIDKFIKALDDKEKFNGKFEIRTPDYSVDIYFKNKSKESYSLW
FT                   LGEEDNIQGILMDENTIWYIDKKSNPTLRKLLS"
     MEKLNVFRDK KGIEKVTLLM ILFTISLLMG CNNSISKGKK VDYIEVVKLS DNKKWTFLEK        60
     DEIDKFIKAL DDKEKFNGKF EIRTPDYSVD IYFKNKSKES YSLWLGEEDN IQGILMDENT       120
     IWYIDKKSNP TLRKLLS                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page