(data stored in ACNUC7421 zone)

EMBL: CP002160.PE415

CP002160.PE415       Location/Qualifiers
FT   CDS             541675..542079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50206"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQD9"
FT                   /inference="similar to AA sequence:KEGG:Athe_0297"
FT                   /protein_id="ADL50206.1"
FT                   /translation="MMTKLRSKVFSFILTILAAISFMAVPASALTYSSSSVKSSWTNSS
FT                   YTYYSANIVNNDVQIQGGISYSQAISRIKAGQSVMCYSKSTARNIAYAAGGNKTPVGPE
FT                   IHGSLNNGYYYHYHVYNRATHAHIWYYSQS"
     MMTKLRSKVF SFILTILAAI SFMAVPASAL TYSSSSVKSS WTNSSYTYYS ANIVNNDVQI        60
     QGGISYSQAI SRIKAGQSVM CYSKSTARNI AYAAGGNKTP VGPEIHGSLN NGYYYHYHVY       120
     NRATHAHIWY YSQS                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page