(data stored in ACNUC7421 zone)

EMBL: CP002160.PE419

CP002160.PE419       Location/Qualifiers
FT   CDS             complement(544759..545856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tit:Thit_2064 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50210"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE3"
FT                   /inference="similar to AA sequence:KEGG:Thit_2064"
FT                   /protein_id="ADL50210.1"
FT                   /translation="MKCPNEGLIQAYIDKELNDFEMKEIEIHLSQCEKCKETYTELNSL
FT                   NKFTLEKLNVYKEDFNVSNLKPTNLNIEMKSKKGVFKDMKKYKNIAVAACAALAITTCV
FT                   TVEPIRATIIDAVSIFRAKEIKSVDISLSDINDLEKALQEHKTDIDIDKIGKVNFHGGE
FT                   RKTVTLDEAKTTLPFTLSLPTALSDKTIESVVIDEPSKIDFTLNVENVNEILKSLGGKN
FT                   IFPKDLDGKTFSFNTSGILNVSYRDVADNKHISVTESKVPELLAPADANVDEIFNALSE
FT                   LSVLPPNIQKQLKSMKDWQNTLYVPNVENEFEELDLGGTKAVGHFEDTNENKNSYVLIL
FT                   KNDVLISLYGNVDKNEILEIAKTMR"
     MKCPNEGLIQ AYIDKELNDF EMKEIEIHLS QCEKCKETYT ELNSLNKFTL EKLNVYKEDF        60
     NVSNLKPTNL NIEMKSKKGV FKDMKKYKNI AVAACAALAI TTCVTVEPIR ATIIDAVSIF       120
     RAKEIKSVDI SLSDINDLEK ALQEHKTDID IDKIGKVNFH GGERKTVTLD EAKTTLPFTL       180
     SLPTALSDKT IESVVIDEPS KIDFTLNVEN VNEILKSLGG KNIFPKDLDG KTFSFNTSGI       240
     LNVSYRDVAD NKHISVTESK VPELLAPADA NVDEIFNALS ELSVLPPNIQ KQLKSMKDWQ       300
     NTLYVPNVEN EFEELDLGGT KAVGHFEDTN ENKNSYVLIL KNDVLISLYG NVDKNEILEI       360
     AKTMR                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page