(data stored in ACNUC7421 zone)

EMBL: CP002160.PE420

CP002160.PE420       Location/Qualifiers
FT   CDS             complement(545853..546389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0434"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: tit:Thit_2063 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: Sigma-70 region 4 type 2;
FT                   sigma-70 region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50211"
FT                   /db_xref="GOA:D9SQE4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADL50211.1"
FT                   /translation="MGVISYFKKKKDKQSLKNIYEEFYNPIYKKISYLTGDMHVAEDLT
FT                   QEVFMKLYNSPPDHDNIAAWLNKVSTNISYNYIRDKKNHENKNEIIYEKEVSNIISIEE
FT                   IAINNCEINLTRKVLNMLSPRDRMCLLLKFSGYKYSEIAETIKIDKNSVGTVISRAQAK
FT                   FKENYLKAEEGVNRK"
     MGVISYFKKK KDKQSLKNIY EEFYNPIYKK ISYLTGDMHV AEDLTQEVFM KLYNSPPDHD        60
     NIAAWLNKVS TNISYNYIRD KKNHENKNEI IYEKEVSNII SIEEIAINNC EINLTRKVLN       120
     MLSPRDRMCL LLKFSGYKYS EIAETIKIDK NSVGTVISRA QAKFKENYLK AEEGVNRK         178
//

If you have problems or comments...

PBIL Back to PBIL home page