(data stored in ACNUC7421 zone)

EMBL: CP002160.PE423

CP002160.PE423       Location/Qualifiers
FT   CDS             548519..549277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0437"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: eel:EUBELI_01396 polar amino acid transport
FT                   system ATP-binding protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50214"
FT                   /db_xref="GOA:D9SQE7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQE7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50214.1"
FT                   /translation="MKILEINNMKKSFDNLEVIKDISLSVNEGEVLSIIGPSGSGKSTV
FT                   LRCATMLETMDSGELIYLGEHAARKDVDGKSIYASKKNLKRIHKHFGLVFQNFNLFPHY
FT                   TVLKNIIDAPITVDKISKKEAEERAMVLLKKLGLEDKKDAYPFQLSGGQQQRVSIARAL
FT                   ALQPKILFFDEPTSALDPELTGEVLKVIKELAKEKMTMIIVTHEMQFAKELSDRIIFME
FT                   NGIIQEEGTPEEVFTTDNSRVKEFIGKFIG"
     MKILEINNMK KSFDNLEVIK DISLSVNEGE VLSIIGPSGS GKSTVLRCAT MLETMDSGEL        60
     IYLGEHAARK DVDGKSIYAS KKNLKRIHKH FGLVFQNFNL FPHYTVLKNI IDAPITVDKI       120
     SKKEAEERAM VLLKKLGLED KKDAYPFQLS GGQQQRVSIA RALALQPKIL FFDEPTSALD       180
     PELTGEVLKV IKELAKEKMT MIIVTHEMQF AKELSDRIIF MENGIIQEEG TPEEVFTTDN       240
     SRVKEFIGKF IG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page