(data stored in ACNUC7421 zone)

EMBL: CP002160.PE427

CP002160.PE427       Location/Qualifiers
FT   CDS             552802..553197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_0376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50218"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF1"
FT                   /inference="similar to AA sequence:KEGG:Cyan8802_0376"
FT                   /protein_id="ADL50218.1"
FT                   /translation="MKNVPDTPVGRLYSQHIHHVENQEIEALMNQYTDDCVLISSFTKT
FT                   PLYYRGKEQLREHLNGILDMKGLVTEVAFYSETENPQTLMVTEKITTIGENGEEVHMRF
FT                   ADSWVLRDGKIAIHFAGMVQYSDGSLA"
     MKNVPDTPVG RLYSQHIHHV ENQEIEALMN QYTDDCVLIS SFTKTPLYYR GKEQLREHLN        60
     GILDMKGLVT EVAFYSETEN PQTLMVTEKI TTIGENGEEV HMRFADSWVL RDGKIAIHFA       120
     GMVQYSDGSL A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page