(data stored in ACNUC7421 zone)

EMBL: CP002160.PE428

CP002160.PE428       Location/Qualifiers
FT   CDS             553290..554051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0442"
FT                   /product="ThiJ/PfpI domain-containing protein"
FT                   /note="PFAM: ThiJ/PfpI domain-containing protein; KEGG:
FT                   syd:Syncc9605_0828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50219"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032633"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF2"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADL50219.1"
FT                   /translation="MSKKILIIASNLGLWGEELQAPWDALKNAGHEVTLATMTGKTPLP
FT                   LVISMDDTFIDPMQGYNVNPKFVVDRIKKILETGQWNNPIKIEDAKMEDYDAIALVGGP
FT                   GSPFDIVGNNDVHKLLLEAYKSNKIIGALCYVVGALVLTRDPDNEKKSIIYGRKVTAHP
FT                   AAWDIYSPLKYPLYGASPKNPGTDITTPGFVYQLQPLVEDAVGPNGQVFSDPRTNRENP
FT                   LCIYDHPFVTALSVESSIAYGNRLVEVLGSL"
     MSKKILIIAS NLGLWGEELQ APWDALKNAG HEVTLATMTG KTPLPLVISM DDTFIDPMQG        60
     YNVNPKFVVD RIKKILETGQ WNNPIKIEDA KMEDYDAIAL VGGPGSPFDI VGNNDVHKLL       120
     LEAYKSNKII GALCYVVGAL VLTRDPDNEK KSIIYGRKVT AHPAAWDIYS PLKYPLYGAS       180
     PKNPGTDITT PGFVYQLQPL VEDAVGPNGQ VFSDPRTNRE NPLCIYDHPF VTALSVESSI       240
     AYGNRLVEVL GSL                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page