(data stored in ACNUC7421 zone)

EMBL: CP002160.PE429

CP002160.PE429       Location/Qualifiers
FT   CDS             554086..554907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0443"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   syd:Syncc9605_0829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50220"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF3"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADL50220.1"
FT                   /translation="MEASNMKVINKAGITIHISSSPLDGEKVNSIIVESQNKLVVIDVP
FT                   LLRPYSKDFRAYANQLGKPIDRVIITHAHPDHWAGLEAFEDLPIYSLSETQEEIQENGE
FT                   WMLTYHRSLHGDLITDKKIVPNNIIEEGKLIIDSVEYNAIKVTEAEYKHLLVLELPRIK
FT                   TLISQDMVYNKVYLFLGELTSTGELACDNWIDELKKYKEKNYEVVIPGHGEPTDSSIID
FT                   ENINYIIEAKGIIKTSKDSDEFKNRMIEKFPDYEIPLMLDMTAYFIYMQNK"
     MEASNMKVIN KAGITIHISS SPLDGEKVNS IIVESQNKLV VIDVPLLRPY SKDFRAYANQ        60
     LGKPIDRVII THAHPDHWAG LEAFEDLPIY SLSETQEEIQ ENGEWMLTYH RSLHGDLITD       120
     KKIVPNNIIE EGKLIIDSVE YNAIKVTEAE YKHLLVLELP RIKTLISQDM VYNKVYLFLG       180
     ELTSTGELAC DNWIDELKKY KEKNYEVVIP GHGEPTDSSI IDENINYIIE AKGIIKTSKD       240
     SDEFKNRMIE KFPDYEIPLM LDMTAYFIYM QNK                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page