(data stored in ACNUC7421 zone)

EMBL: CP002160.PE43

CP002160.PE43        Location/Qualifiers
FT   CDS             81936..82379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0045"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   cac:CAC0123 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49834"
FT                   /db_xref="GOA:D9SMP9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP9"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADL49834.1"
FT                   /translation="MNNNFLKIAIEEAKKARELGEVPVGAVIIKDDKVIAAAHNLKETK
FT                   KEVTAHAELLAIKMASEILDNWRLNDCEIYVTLEPCAMCASAIVQSRIKKIYIGTFEPT
FT                   TGACGSVINLVQNEALNSFVHVEWLYSDECSDIITEFFKERRS"
     MNNNFLKIAI EEAKKARELG EVPVGAVIIK DDKVIAAAHN LKETKKEVTA HAELLAIKMA        60
     SEILDNWRLN DCEIYVTLEP CAMCASAIVQ SRIKKIYIGT FEPTTGACGS VINLVQNEAL       120
     NSFVHVEWLY SDECSDIITE FFKERRS                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page