(data stored in ACNUC7421 zone)

EMBL: CP002160.PE431

CP002160.PE431       Location/Qualifiers
FT   CDS             556924..557568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0446"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: amt:Amet_4729 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver; transcriptional regulator
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50222"
FT                   /db_xref="GOA:D9SQF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADL50222.1"
FT                   /translation="MAKILIVEDDISINELMKRNLSLIGHECKSIFDGQVALTAITQEN
FT                   FDLIILDVMLPGCSGFEIVKHIKAIPVMFVTAKDSLQDKLQGLSSGAEDYLVKPFEILE
FT                   LIARVNIILRRNNKNDDFILGLVRVNFKCRKVFFNDIEIEMTPQEYMLLEVLITNRNIA
FT                   MSREKLLELAWGFDYEGDTRTVDVHIQKLRKKLSLEEQIKTVYKLGYRLED"
     MAKILIVEDD ISINELMKRN LSLIGHECKS IFDGQVALTA ITQENFDLII LDVMLPGCSG        60
     FEIVKHIKAI PVMFVTAKDS LQDKLQGLSS GAEDYLVKPF EILELIARVN IILRRNNKND       120
     DFILGLVRVN FKCRKVFFND IEIEMTPQEY MLLEVLITNR NIAMSREKLL ELAWGFDYEG       180
     DTRTVDVHIQ KLRKKLSLEE QIKTVYKLGY RLED                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page