(data stored in ACNUC7421 zone)

EMBL: CP002160.PE432

CP002160.PE432       Location/Qualifiers
FT   CDS             557575..558978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0447"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: amt:Amet_4730 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50223"
FT                   /db_xref="GOA:D9SQF6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL50223.1"
FT                   /translation="MKFWTKTYFAVLILFLLVFNGSILGILHTTYQYILSSEKEKALGE
FT                   HHFIKNTIENDMDNLSVNNKLSQSAIENLMNYYSDYYDKQDVSFLLMKNSNVAFSNLQY
FT                   EEENLKEEFFNVDSGQNIILQGDTNSKFILVSGTIENSKDKYSFVYCYKLEGVIILWTK
FT                   LENTFVYFSFFISLVLALLLGLMLNKRSKPLKQLINFVDEIKDGNYHSKVQLHGRDEFA
FT                   MLGNNFNEMAEKIRETLEQLNNDMEMKQQFIDNLSHELRTPLTSIYGYADYIQKAAISE
FT                   EDKYESTQYIMEESKRLQYMANRLLDMTIRKQKSIVKEKIIVEELLDKVKRTITPIADE
FT                   KLISINISNTLSEIFGERELIESVMVNLLDNAVKASEEKGSIEILTIHFNGEDIIQIID
FT                   KGKGIAEEHLRHITEPFFRTDKARSKAEGGVGLGLTLCKQVMDMHDGKLKISSQLDKGT
FT                   TVSLIFTTL"
     MKFWTKTYFA VLILFLLVFN GSILGILHTT YQYILSSEKE KALGEHHFIK NTIENDMDNL        60
     SVNNKLSQSA IENLMNYYSD YYDKQDVSFL LMKNSNVAFS NLQYEEENLK EEFFNVDSGQ       120
     NIILQGDTNS KFILVSGTIE NSKDKYSFVY CYKLEGVIIL WTKLENTFVY FSFFISLVLA       180
     LLLGLMLNKR SKPLKQLINF VDEIKDGNYH SKVQLHGRDE FAMLGNNFNE MAEKIRETLE       240
     QLNNDMEMKQ QFIDNLSHEL RTPLTSIYGY ADYIQKAAIS EEDKYESTQY IMEESKRLQY       300
     MANRLLDMTI RKQKSIVKEK IIVEELLDKV KRTITPIADE KLISINISNT LSEIFGEREL       360
     IESVMVNLLD NAVKASEEKG SIEILTIHFN GEDIIQIIDK GKGIAEEHLR HITEPFFRTD       420
     KARSKAEGGV GLGLTLCKQV MDMHDGKLKI SSQLDKGTTV SLIFTTL                     467
//

If you have problems or comments...

PBIL Back to PBIL home page