(data stored in ACNUC7421 zone)

EMBL: CP002160.PE435

CP002160.PE435       Location/Qualifiers
FT   CDS             complement(560455..561441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1992 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50226"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQF9"
FT                   /inference="similar to AA sequence:KEGG:Clos_1992"
FT                   /protein_id="ADL50226.1"
FT                   /translation="MKNKKIALLITISLSIITLTSCTKDAQSSTSITAQNPKAEDSTFK
FT                   ADSSPSTKETTETTKTTENAEKITPANAVTKLDGRREEFLVRLDIIQKRLDLLPEKKNS
FT                   DAGITISMKSFYGDSYRCYDDALNEIYNLLKEQLSQDIMKNLEAEEINWITQKENAANA
FT                   AASEFKGGTFEPVAYNTSLYNSTKARCYELVNNYMTDSKFKINANKEEYLKELANIENE
FT                   LLSSQEYKDAGSGTTNSMFTYADKKYIKWDEQLNKIYSLLKQQLPSDEMSKLNKEELQW
FT                   ITQKETKAKKSEESQGVGSQLGSVAYQASLAFVTESRCYELVYKYMK"
     MKNKKIALLI TISLSIITLT SCTKDAQSST SITAQNPKAE DSTFKADSSP STKETTETTK        60
     TTENAEKITP ANAVTKLDGR REEFLVRLDI IQKRLDLLPE KKNSDAGITI SMKSFYGDSY       120
     RCYDDALNEI YNLLKEQLSQ DIMKNLEAEE INWITQKENA ANAAASEFKG GTFEPVAYNT       180
     SLYNSTKARC YELVNNYMTD SKFKINANKE EYLKELANIE NELLSSQEYK DAGSGTTNSM       240
     FTYADKKYIK WDEQLNKIYS LLKQQLPSDE MSKLNKEELQ WITQKETKAK KSEESQGVGS       300
     QLGSVAYQAS LAFVTESRCY ELVYKYMK                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page