(data stored in ACNUC7421 zone)

EMBL: CP002160.PE448

CP002160.PE448       Location/Qualifiers
FT   CDS             576282..577487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0463"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; RNA-binding S4 domain
FT                   protein; KEGG: cdl:CDR20291_1370 tyrosyl-tRNA synthetase;
FT                   SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50239"
FT                   /db_xref="GOA:D9SQH3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH3"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADL50239.1"
FT                   /translation="MVNIDEQIKIIMKGVDEIIGLDSLKEKIEKANENGKPLIVKLGLD
FT                   PSAPDIHLGHTVVLRKMKQLQDLGHKVIVIIGDFTGKIGDPTGKTKGRKALTTEQVLEN
FT                   ARTYETQIFKVLDKDKTEVRFNSEWLSQLSFEETIKLAATMTVARMLEREEFKKRYENQ
FT                   VPISVHEFFYPLMQGYDSVAIHADIELGGTDQRFNVLMGRMLQKEYGQEPQTTIFMPLL
FT                   EGLDGKEKMSKSLGNYIGIDEKAEVMYEKAMTVPDNLIIKYFNLVTDMHPDKVKELEST
FT                   LRDEKVNPRDIKMRLAKEIVRLYHGEKEAEKAEERFMLIFQKGKIPTDIETVNVSENNF
FT                   DIGEILVSEKFVASKSDLRRLIDQGGVKINNNILKDLAEIKIEKEMIVQVGKKKFIHIS
FT                   IA"
     MVNIDEQIKI IMKGVDEIIG LDSLKEKIEK ANENGKPLIV KLGLDPSAPD IHLGHTVVLR        60
     KMKQLQDLGH KVIVIIGDFT GKIGDPTGKT KGRKALTTEQ VLENARTYET QIFKVLDKDK       120
     TEVRFNSEWL SQLSFEETIK LAATMTVARM LEREEFKKRY ENQVPISVHE FFYPLMQGYD       180
     SVAIHADIEL GGTDQRFNVL MGRMLQKEYG QEPQTTIFMP LLEGLDGKEK MSKSLGNYIG       240
     IDEKAEVMYE KAMTVPDNLI IKYFNLVTDM HPDKVKELES TLRDEKVNPR DIKMRLAKEI       300
     VRLYHGEKEA EKAEERFMLI FQKGKIPTDI ETVNVSENNF DIGEILVSEK FVASKSDLRR       360
     LIDQGGVKIN NNILKDLAEI KIEKEMIVQV GKKKFIHISI A                           401
//

If you have problems or comments...

PBIL Back to PBIL home page