(data stored in ACNUC7421 zone)

EMBL: CP002160.PE45

CP002160.PE45        Location/Qualifiers
FT   CDS             complement(85197..86177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0047"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: cbe:Cbei_4326
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49836"
FT                   /db_xref="GOA:D9SMQ1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ1"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADL49836.1"
FT                   /translation="MNTIINKIIHNLINNYGFVVEKYGDNVNNSDKLVLLKYLPDGIYS
FT                   VIFSNAYDEASNAMFLRKYLLVKGQKFIINNIIFLESTHNYIPSSPFYNYMLIDSKAKI
FT                   ILYSNIAIDSLRSSVENSLFSRKHIKNNLFSSNQITSIIIFLNIVIFLYSSYINGDIFD
FT                   INTLILVQLGAKVNSYIINGEFYRLLTCTFLHSGLMHIAFNMYALNNIGRLIERVYGWK
FT                   KFILIYIFAGLSGSLASFLFSPYVSVGASGAIFGLFGAALIMGLKLKKYINSNFLGSLA
FT                   SVIVVNVIFGFSSTGIDNYGHIGGLLGGLLMGALLFNKKNALAKL"
     MNTIINKIIH NLINNYGFVV EKYGDNVNNS DKLVLLKYLP DGIYSVIFSN AYDEASNAMF        60
     LRKYLLVKGQ KFIINNIIFL ESTHNYIPSS PFYNYMLIDS KAKIILYSNI AIDSLRSSVE       120
     NSLFSRKHIK NNLFSSNQIT SIIIFLNIVI FLYSSYINGD IFDINTLILV QLGAKVNSYI       180
     INGEFYRLLT CTFLHSGLMH IAFNMYALNN IGRLIERVYG WKKFILIYIF AGLSGSLASF       240
     LFSPYVSVGA SGAIFGLFGA ALIMGLKLKK YINSNFLGSL ASVIVVNVIF GFSSTGIDNY       300
     GHIGGLLGGL LMGALLFNKK NALAKL                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page