(data stored in ACNUC7421 zone)

EMBL: CP002160.PE451

CP002160.PE451       Location/Qualifiers
FT   CDS             579915..582434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0466"
FT                   /product="Dockerin type 1"
FT                   /note="PFAM: Dockerin type 1; FG-GAP repeat protein; KEGG:
FT                   cth:Cthe_0246 carbohydrate-binding family 6 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50242"
FT                   /db_xref="GOA:D9SQH5"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR034641"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="InterPro:IPR041624"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH5"
FT                   /inference="protein motif:PFAM:PF00404"
FT                   /protein_id="ADL50242.1"
FT                   /translation="MLKKALLSVFMGAAVLLGSIAPQTITTTAATARQMENLDRGVVAV
FT                   KVSNGVFVSWRVLGTEATNVSYNLYRDSVKVANITGASNYIDASGTTTSKYSVSAVVNG
FT                   VEQSKSTAVSVLGNNYMQLPLQIPAGGKTPDGVAYTYNANDCSVGDLDGDGQYEIVLKW
FT                   DPSNSKDNSQKGYTGNVFLDAYEMNGTRLWRIDLGKNIRAGAHYTQFMVYDLNGDGKAE
FT                   VACKTSDGTKDGVGTVIGNASADYRNSSGYILSGPEYLTIFQGSNGKALNTINYEPGRG
FT                   NVSSWGDSYGNRVDRFLGCIAYLDGVHPSLVMCRGYYTRAVLVAYDWNGSTLTKRWTFD
FT                   SNTSGNSGYAGQGNHNLSVADVDSDGKDEIIYGGCTIDDSGKGLYTTGLRHGDALHVSD
FT                   LDPSRPGLEVWSCHEDTSGNGGIGGSFRDAKTGQVLWSFKAANDTGRACSADVTAAYPG
FT                   EEVWASGSSLYSSKGENIGNRPGPVNFAIWWDGDELRELLDDTTISKYGGGNLLSVSDC
FT                   DSNNTTKATPCLQADILGDWREEVIWRTTDNKYLRIYTTTATTSRRIYTLMHDPVYRMG
FT                   VAWQNVAYNQPPHTGFFLGSGMSTPPTPAIYLAGAVAPVPIPEPIPDGQHIKTLTVKDT
FT                   DNAADWSIQSNLQVGDIVYGDRTNKFSVIPSKLLGAEWIRTACDSKLYTSDLAAFTTKS
FT                   DVSVYVGLDARITSIPSWISSWINTGEVLTNDSAVTFNLYKKDFSANSNVVLGTNGASS
FT                   SSVNYTVIVVPNTAPTLIYGDVNGDGVANAIDYAVMKKYLLGTITSMPSANWQKVGDLN
FT                   SDGVINAIDYAYFKKYLLGSITKLPVS"
     MLKKALLSVF MGAAVLLGSI APQTITTTAA TARQMENLDR GVVAVKVSNG VFVSWRVLGT        60
     EATNVSYNLY RDSVKVANIT GASNYIDASG TTTSKYSVSA VVNGVEQSKS TAVSVLGNNY       120
     MQLPLQIPAG GKTPDGVAYT YNANDCSVGD LDGDGQYEIV LKWDPSNSKD NSQKGYTGNV       180
     FLDAYEMNGT RLWRIDLGKN IRAGAHYTQF MVYDLNGDGK AEVACKTSDG TKDGVGTVIG       240
     NASADYRNSS GYILSGPEYL TIFQGSNGKA LNTINYEPGR GNVSSWGDSY GNRVDRFLGC       300
     IAYLDGVHPS LVMCRGYYTR AVLVAYDWNG STLTKRWTFD SNTSGNSGYA GQGNHNLSVA       360
     DVDSDGKDEI IYGGCTIDDS GKGLYTTGLR HGDALHVSDL DPSRPGLEVW SCHEDTSGNG       420
     GIGGSFRDAK TGQVLWSFKA ANDTGRACSA DVTAAYPGEE VWASGSSLYS SKGENIGNRP       480
     GPVNFAIWWD GDELRELLDD TTISKYGGGN LLSVSDCDSN NTTKATPCLQ ADILGDWREE       540
     VIWRTTDNKY LRIYTTTATT SRRIYTLMHD PVYRMGVAWQ NVAYNQPPHT GFFLGSGMST       600
     PPTPAIYLAG AVAPVPIPEP IPDGQHIKTL TVKDTDNAAD WSIQSNLQVG DIVYGDRTNK       660
     FSVIPSKLLG AEWIRTACDS KLYTSDLAAF TTKSDVSVYV GLDARITSIP SWISSWINTG       720
     EVLTNDSAVT FNLYKKDFSA NSNVVLGTNG ASSSSVNYTV IVVPNTAPTL IYGDVNGDGV       780
     ANAIDYAVMK KYLLGTITSM PSANWQKVGD LNSDGVINAI DYAYFKKYLL GSITKLPVS        839
//

If you have problems or comments...

PBIL Back to PBIL home page