(data stored in ACNUC7421 zone)

EMBL: CP002160.PE46

CP002160.PE46        Location/Qualifiers
FT   CDS             complement(86417..86662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0048"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: cbi:CLJ_B0097 transcriptional regulator, AbrB
FT                   family; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49837"
FT                   /db_xref="GOA:D9SMQ2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ2"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADL49837.1"
FT                   /translation="MRSTGIVRKVDELGRIVIPIELRRTLDIEIKDALEIYVNSEEIIL
FT                   KKYQPSCIFCGEVKDVENYKGKKICHNCLNELKENV"
     MRSTGIVRKV DELGRIVIPI ELRRTLDIEI KDALEIYVNS EEIILKKYQP SCIFCGEVKD        60
     VENYKGKKIC HNCLNELKEN V                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page