(data stored in ACNUC7421 zone)

EMBL: CP002160.PE463

CP002160.PE463       Location/Qualifiers
FT   CDS             complement(593927..594196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0478"
FT                   /product="Mor transcription activator domain protein"
FT                   /note="PFAM: Mor transcription activator domain protein;
FT                   KEGG: cbe:Cbei_0358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50254"
FT                   /db_xref="GOA:D9SQW6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQW6"
FT                   /inference="protein motif:PFAM:PF08765"
FT                   /protein_id="ADL50254.1"
FT                   /translation="MSYIKATDVLPEEILLLIQQYVDGEYLYIPRKETNKKSWGENTNS
FT                   RKELSLRNSNIYNDYRKGLNIKNLSSKYFLSEKSIQRIIRQSNR"
     MSYIKATDVL PEEILLLIQQ YVDGEYLYIP RKETNKKSWG ENTNSRKELS LRNSNIYNDY        60
     RKGLNIKNLS SKYFLSEKSI QRIIRQSNR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page