(data stored in ACNUC7421 zone)

EMBL: CP002160.PE464

CP002160.PE464       Location/Qualifiers
FT   CDS             594813..596486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0479"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: methyl-accepting chemotaxis sensory transducer
FT                   with cache sensor; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50255"
FT                   /db_xref="GOA:D9SQW7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQW7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50255.1"
FT                   /translation="MKIKTKLILSISLIVVLSLISISSSFFVSRLQKNDALLINVAGRE
FT                   RMLSQRISKNVFLLFSKDKLEGTEIEAVKKELSASVALYDETLSGFLYGGEITSASGEK
FT                   VTISDIGDDKVYAADINEIWIEFKKATDKVLLNQDESALQYIKENSNELLKRSNDVTVA
FT                   LEKTSEKKLQLQHDIQLASAIVIVILFTFVVLIISKDVVKPINDLVVLTQRVAQGNLNI
FT                   KFDDRYKGEFKVLFRNFSIMVNNLRDSIKDTVKICDDVMYESQQLTSYSEMIANSSKEV
FT                   TKAIEEVANGATDQANEVATSLKITQDLSSLLDKMIDYVSRTKQSVVLMQDSSNNCISQ
FT                   IQQLEGAIEGNLCENKKINSDIFVLSEKSSDISSILTTITTIAEQTNLLALNAAIEAAR
FT                   AGEQGKGFAVVAEEIRKLAEASGVAANQIQLIVSDIVDVIMTTRNAMDAMDKTMRITTE
FT                   TMDDTKQSLRVIENSIDSVIDNTDTEAKAINEISYHKEEVLQNIQHISSIIEMSAAAVE
FT                   EISATTVQELQDIENLNRSIFNLNDKVKKFEETNKHFNLE"
     MKIKTKLILS ISLIVVLSLI SISSSFFVSR LQKNDALLIN VAGRERMLSQ RISKNVFLLF        60
     SKDKLEGTEI EAVKKELSAS VALYDETLSG FLYGGEITSA SGEKVTISDI GDDKVYAADI       120
     NEIWIEFKKA TDKVLLNQDE SALQYIKENS NELLKRSNDV TVALEKTSEK KLQLQHDIQL       180
     ASAIVIVILF TFVVLIISKD VVKPINDLVV LTQRVAQGNL NIKFDDRYKG EFKVLFRNFS       240
     IMVNNLRDSI KDTVKICDDV MYESQQLTSY SEMIANSSKE VTKAIEEVAN GATDQANEVA       300
     TSLKITQDLS SLLDKMIDYV SRTKQSVVLM QDSSNNCISQ IQQLEGAIEG NLCENKKINS       360
     DIFVLSEKSS DISSILTTIT TIAEQTNLLA LNAAIEAARA GEQGKGFAVV AEEIRKLAEA       420
     SGVAANQIQL IVSDIVDVIM TTRNAMDAMD KTMRITTETM DDTKQSLRVI ENSIDSVIDN       480
     TDTEAKAINE ISYHKEEVLQ NIQHISSIIE MSAAAVEEIS ATTVQELQDI ENLNRSIFNL       540
     NDKVKKFEET NKHFNLE                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page