(data stored in ACNUC7421 zone)

EMBL: CP002160.PE467

CP002160.PE467       Location/Qualifiers
FT   CDS             complement(600744..601010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfs:BF4188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50258"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX0"
FT                   /inference="similar to AA sequence:KEGG:BF4188"
FT                   /protein_id="ADL50258.1"
FT                   /translation="MKKRIIYLLMAFSTYISILSTTVFAETTPLPEVQNTFSENIRTNG
FT                   SFGTSTLLTLRNKLIKKVRYVDTLFDNYILDKDITYKTAINYL"
     MKKRIIYLLM AFSTYISILS TTVFAETTPL PEVQNTFSEN IRTNGSFGTS TLLTLRNKLI        60
     KKVRYVDTLF DNYILDKDIT YKTAINYL                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page