(data stored in ACNUC7421 zone)

EMBL: CP002160.PE473

CP002160.PE473       Location/Qualifiers
FT   CDS             607973..608545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0489"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: ckr:CKR_0849 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50264"
FT                   /db_xref="GOA:D9SQX6"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX6"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADL50264.1"
FT                   /translation="MKNTRDLILVALFAALTAVGAFIKIPIPYVPFTLQYFFCALAGII
FT                   LGSKLGALSQIIYVAVGLVGAPVFTDGGGITYIFKPTFGYLIGFIVAAYVIGKIREKII
FT                   ELTFIKTVLAFLSGLFFIYLFGVIYLYISYNLYLGKSISFYFAFFYGFITCIGGDLVLT
FT                   VLASYIAIRVLPILKKAGYISKISTSL"
     MKNTRDLILV ALFAALTAVG AFIKIPIPYV PFTLQYFFCA LAGIILGSKL GALSQIIYVA        60
     VGLVGAPVFT DGGGITYIFK PTFGYLIGFI VAAYVIGKIR EKIIELTFIK TVLAFLSGLF       120
     FIYLFGVIYL YISYNLYLGK SISFYFAFFY GFITCIGGDL VLTVLASYIA IRVLPILKKA       180
     GYISKISTSL                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page