(data stored in ACNUC7421 zone)

EMBL: CP002160.PE474

CP002160.PE474       Location/Qualifiers
FT   CDS             608734..609717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0490"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="SMART: biotin and thiamin synthesis associated;
FT                   Elongator protein 3/MiaB/NifB; TIGRFAM: biotin synthase;
FT                   KEGG: ckr:CKR_1576 hypothetical protein; PFAM: biotin and
FT                   thiamin synthesis associated; Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50265"
FT                   /db_xref="GOA:D9SQX7"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX7"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ADL50265.1"
FT                   /translation="MINLIKDLEKKVLEGETINFQEAMDLASIEGKAEIKELCNSANNI
FT                   RKFFCGNEVDLCSIMNAKSGQCSEDCKFCAQSAHYKTKVEVYSLVSKEAAVKLAKENES
FT                   EGVNRFSLVTSGKGLSKNDFPKVLEIYKALNEKIKIDLCVSLGILEYQEFLKLKDVGIT
FT                   MYHHNLETSEEFYSKICTTHSYQERIDTINAAKKAGVDICSGGIIGLGETFEDRISLAL
FT                   KLRELEVKSIPINILNPIEGTPLENNEALSQEEILKTVAIFRFINPKVLIRLAGGRNLI
FT                   NQYGKECFNAGVNATITGNYLTTSGNKICDDKAMIRELNLEVRKNV"
     MINLIKDLEK KVLEGETINF QEAMDLASIE GKAEIKELCN SANNIRKFFC GNEVDLCSIM        60
     NAKSGQCSED CKFCAQSAHY KTKVEVYSLV SKEAAVKLAK ENESEGVNRF SLVTSGKGLS       120
     KNDFPKVLEI YKALNEKIKI DLCVSLGILE YQEFLKLKDV GITMYHHNLE TSEEFYSKIC       180
     TTHSYQERID TINAAKKAGV DICSGGIIGL GETFEDRISL ALKLRELEVK SIPINILNPI       240
     EGTPLENNEA LSQEEILKTV AIFRFINPKV LIRLAGGRNL INQYGKECFN AGVNATITGN       300
     YLTTSGNKIC DDKAMIRELN LEVRKNV                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page