(data stored in ACNUC7421 zone)

EMBL: CP002160.PE476

CP002160.PE476       Location/Qualifiers
FT   CDS             610528..611892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0492"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="KEGG: ckr:CKR_0851 hypothetical protein; TIGRFAM:
FT                   adenosylmethionine-8-amino-7-oxononanoate aminotransferase;
FT                   PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50267"
FT                   /db_xref="GOA:D9SQX9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX9"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ADL50267.1"
FT                   /translation="MTDIYDNDYVKKDLKYIWHPCSQMKDYEELKPIVIEKGEGVWLYD
FT                   IHGNKYLDCISSWWTNTLGHSNKRINEAIKKQIDSLEHVIFANFSNKPAIELAEKLVAI
FT                   TPEKLSKVFFSDNGSSAVEIALKMSFHYNMQKGRKKKKRFVAISDAYHGETLGALSVCD
FT                   LDDFNTIYRPLLLDTIRAQGPDCYRCQYNCSRESCDAPCFENMEKAIGENYQEISAVII
FT                   EPMVQGAAGMKIYSPIYLKKLRNLCNEYDIHLILDEIAMGFGRTGEMFACNHARISPDF
FT                   MCLSKGISAGYMPMSVVITTDEVYDCFYGDYSERKAFIHSHTYSGNAMACAIALESLKI
FT                   FEEDKILENNKKKGQFIKNLTIKKAETSQHVGDVRSIGMITAIEIVKDNITKEPYTADQ
FT                   RVGYEIYKIALSKGLLLRPIGNVLYFIPPYIITEEEIEFMVDTCFDSIDEYFLDS"
     MTDIYDNDYV KKDLKYIWHP CSQMKDYEEL KPIVIEKGEG VWLYDIHGNK YLDCISSWWT        60
     NTLGHSNKRI NEAIKKQIDS LEHVIFANFS NKPAIELAEK LVAITPEKLS KVFFSDNGSS       120
     AVEIALKMSF HYNMQKGRKK KKRFVAISDA YHGETLGALS VCDLDDFNTI YRPLLLDTIR       180
     AQGPDCYRCQ YNCSRESCDA PCFENMEKAI GENYQEISAV IIEPMVQGAA GMKIYSPIYL       240
     KKLRNLCNEY DIHLILDEIA MGFGRTGEMF ACNHARISPD FMCLSKGISA GYMPMSVVIT       300
     TDEVYDCFYG DYSERKAFIH SHTYSGNAMA CAIALESLKI FEEDKILENN KKKGQFIKNL       360
     TIKKAETSQH VGDVRSIGMI TAIEIVKDNI TKEPYTADQR VGYEIYKIAL SKGLLLRPIG       420
     NVLYFIPPYI ITEEEIEFMV DTCFDSIDEY FLDS                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page