(data stored in ACNUC7421 zone)

EMBL: CP002160.PE477

CP002160.PE477       Location/Qualifiers
FT   CDS             complement(612012..613670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0493"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   ckr:CKR_1573 hypothetical protein; PFAM: dihydroxy-acid and
FT                   6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50268"
FT                   /db_xref="GOA:D9SQY0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY0"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADL50268.1"
FT                   /translation="MNSDSLTKDTPKRALLHALGLTNEEMEKPLIGIVSSKNDIVPGHM
FT                   NLDKIVDAVKLGVAMAGGTPLVFPAIAVCDGLAMGHKGMKYSLATRELIADSTEAMTLA
FT                   HSFDALVMVPNCDKNVPGLLMAAARLNIPTIFVSGGPMLAGRVDGEKTSFSSICEADSA
FT                   FKAGKMTKEKLLEFENKACPTCGSCSGMYTANSMNCLTEVLGMGLKGNGTIPAVYSERI
FT                   QLAKHAGMKVMELLKKDIKPRDIMTEAAFKNALTLDMALGCSTNSMLHLPAIAHECGIN
FT                   LDVAIANEISDKTPNLCHLAPAGHTYIEDLNEAGGIYAVMNEVNKLGLLNTDLITCTGK
FT                   TVGENIEGCINKNPEVIRPVENPYSTTGGIAVLKGNLAPDTCVVKRSAVSPEMMKHQGP
FT                   AKVFDCEEDAMAAINSGKIVPGDVVVIRYEGPKGGPGMREMLNPTSAIVGRGLGDTVAL
FT                   ITDGRFSGATRGAAIGHVSPEAAVGGNIALVQDGDIIEIDIMANKIDFVVSDEELEKRR
FT                   ANWKPREPKITSGYLSKYASLVTSGNRGAILELKK"
     MNSDSLTKDT PKRALLHALG LTNEEMEKPL IGIVSSKNDI VPGHMNLDKI VDAVKLGVAM        60
     AGGTPLVFPA IAVCDGLAMG HKGMKYSLAT RELIADSTEA MTLAHSFDAL VMVPNCDKNV       120
     PGLLMAAARL NIPTIFVSGG PMLAGRVDGE KTSFSSICEA DSAFKAGKMT KEKLLEFENK       180
     ACPTCGSCSG MYTANSMNCL TEVLGMGLKG NGTIPAVYSE RIQLAKHAGM KVMELLKKDI       240
     KPRDIMTEAA FKNALTLDMA LGCSTNSMLH LPAIAHECGI NLDVAIANEI SDKTPNLCHL       300
     APAGHTYIED LNEAGGIYAV MNEVNKLGLL NTDLITCTGK TVGENIEGCI NKNPEVIRPV       360
     ENPYSTTGGI AVLKGNLAPD TCVVKRSAVS PEMMKHQGPA KVFDCEEDAM AAINSGKIVP       420
     GDVVVIRYEG PKGGPGMREM LNPTSAIVGR GLGDTVALIT DGRFSGATRG AAIGHVSPEA       480
     AVGGNIALVQ DGDIIEIDIM ANKIDFVVSD EELEKRRANW KPREPKITSG YLSKYASLVT       540
     SGNRGAILEL KK                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page