(data stored in ACNUC7421 zone)

EMBL: CP002160.PE478

CP002160.PE478       Location/Qualifiers
FT   CDS             complement(613885..614571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0494"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: cbe:Cbei_1511 GntR domain-containing protein;
FT                   PFAM: GntR domain protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH; GntR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50269"
FT                   /db_xref="GOA:D9SQY1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY1"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADL50269.1"
FT                   /translation="MIKKDKSLAENVADDIVSMITIDKKYKIGDKLPNENELSSSLHIS
FT                   RTTLREAIRILVTHNVLEIHRGKGTYVKNNQGLSEGFNLDEISSLKVDIKDLYEMRLIF
FT                   EPESAYYAAKRATDKELERILYYGRLEEELILKKEHRTEVELAFHKAIAKATHNEFMNR
FT                   LMPILYRAIDKGVTLSDQNEEMVQNTLNDHRMIMEFLSKRDAEGAKTAMKLHIIHAMRG
FT                   FGITKD"
     MIKKDKSLAE NVADDIVSMI TIDKKYKIGD KLPNENELSS SLHISRTTLR EAIRILVTHN        60
     VLEIHRGKGT YVKNNQGLSE GFNLDEISSL KVDIKDLYEM RLIFEPESAY YAAKRATDKE       120
     LERILYYGRL EEELILKKEH RTEVELAFHK AIAKATHNEF MNRLMPILYR AIDKGVTLSD       180
     QNEEMVQNTL NDHRMIMEFL SKRDAEGAKT AMKLHIIHAM RGFGITKD                    228
//

If you have problems or comments...

PBIL Back to PBIL home page