(data stored in ACNUC7421 zone)

EMBL: CP002160.PE483

CP002160.PE483       Location/Qualifiers
FT   CDS             619530..620306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0499"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: aoe:Clos_2442
FT                   cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50274"
FT                   /db_xref="GOA:D9SQY6"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY6"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ADL50274.1"
FT                   /translation="MKKFIDLSIAIENNIPSDPPEMIPQINYVDHDLGAKQMTVFFPGI
FT                   DTEKDLPNGKGWAMELINLSSHSGTHLDAPWHYSPTMNKGEKAATIDEIPLEWCMGDGV
FT                   KLDFRNFEDGYLVTAKDMEEAFEKIGYELKAGDIVLVNTGADKYWGTPQYLIKGCGMGR
FT                   EATLWLCEKGVHVVGTDAWSWDRPLPIIAKDFNENRDSSVIWEGHFAGIEHGYCHIEKL
FT                   TNLEQLPSYGFTVSCFPIKIKDASAGWIRAVAIVEE"
     MKKFIDLSIA IENNIPSDPP EMIPQINYVD HDLGAKQMTV FFPGIDTEKD LPNGKGWAME        60
     LINLSSHSGT HLDAPWHYSP TMNKGEKAAT IDEIPLEWCM GDGVKLDFRN FEDGYLVTAK       120
     DMEEAFEKIG YELKAGDIVL VNTGADKYWG TPQYLIKGCG MGREATLWLC EKGVHVVGTD       180
     AWSWDRPLPI IAKDFNENRD SSVIWEGHFA GIEHGYCHIE KLTNLEQLPS YGFTVSCFPI       240
     KIKDASAGWI RAVAIVEE                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page