(data stored in ACNUC7421 zone)

EMBL: CP002160.PE484

CP002160.PE484       Location/Qualifiers
FT   CDS             620329..621246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0500"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: gym:GYMC10_4684
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50275"
FT                   /db_xref="GOA:D9SQY7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQY7"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADL50275.1"
FT                   /translation="MTLQQLKYAIEIAKYGSMNIAAKKLFITQPSLSNAIKDLEEEMNI
FT                   TIFERTNRGINITVQGAEFLGYARQVIEQTELLEKKYLNAKPSIQHFSVSTQHYAFAVN
FT                   AFVELIKEYGIDEYEFNLRETKTYEIIDDVKNLRSEIGILYLNEFNSKVLKKIFKENNL
FT                   RFTKLFVAKPHVFISSNNPLSKKNLVTLKDLEYYPYLSFEQGEYNSFHFSEEILSTLSH
FT                   KKSIKVTDRATLFNLLIGLNGYTISTGILSEDLNGEHIISIPLDVKEEIKVGWISHKNM
FT                   TLSKLGTIYISALEDIISKSLKGM"
     MTLQQLKYAI EIAKYGSMNI AAKKLFITQP SLSNAIKDLE EEMNITIFER TNRGINITVQ        60
     GAEFLGYARQ VIEQTELLEK KYLNAKPSIQ HFSVSTQHYA FAVNAFVELI KEYGIDEYEF       120
     NLRETKTYEI IDDVKNLRSE IGILYLNEFN SKVLKKIFKE NNLRFTKLFV AKPHVFISSN       180
     NPLSKKNLVT LKDLEYYPYL SFEQGEYNSF HFSEEILSTL SHKKSIKVTD RATLFNLLIG       240
     LNGYTISTGI LSEDLNGEHI ISIPLDVKEE IKVGWISHKN MTLSKLGTIY ISALEDIISK       300
     SLKGM                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page