(data stored in ACNUC7421 zone)

EMBL: CP002160.PE488

CP002160.PE488       Location/Qualifiers
FT   CDS             623676..625505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0504"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase;
FT                   methylenetetrahydrofolate reductase; KEGG: ckr:CKR_1635
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50279"
FT                   /db_xref="GOA:D9SQZ1"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ1"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ADL50279.1"
FT                   /translation="MNLNERLLIFDGAMGTYYASSCNNPLPKCELANIHDKKTILNIHK
FT                   EYIKAGAGAIKTNTFGANKISLECDFDVMKEAIVSGYEIAKEATEGTDVLVFADIGPIP
FT                   FLEKVDLWVGYKEIIDIFLSLGASNFIFETFSSDEYLIEISEYIKEKNSKAFILTEFAV
FT                   SPEGVTRLGKSGKKLLNTMLKAKTIDACGFNCFSGPYHLLQYSKTLDIKDKTISMMPNS
FT                   GYPSMINNRVFFDNTKEYFAEQMLEIARQGVTILGGCCGTTPEYIKEMVDKLKGLEVHN
FT                   ILNDGRQIETTEGLKQEKLQEKKALTEEVKDEKRVNKNPLLEKLERGEKIIAVELDPPI
FT                   NTEIDFFISGAKRLKGQGIDAITIADCPIARARVDSSLLACKLKRELDITAIPHMTCRD
FT                   RNINATKALLLGLNVEGINNVLVVTGDPIPSADREEIKGVFSFNSSILSSYIRELNETT
FT                   FSSPFNVCGALNLNVRNFSNELEKAQKKIDNGITMFLTQPVLTEEAMENLKLARKKLNA
FT                   KILGGIIPVVSYRNACFMNNEISGINVSEEIIERYKDVSKEEATRLAVEISTGIATEMS
FT                   SYVDGFYIITPFKRIDIVSEIVSNIKNNIFTYN"
     MNLNERLLIF DGAMGTYYAS SCNNPLPKCE LANIHDKKTI LNIHKEYIKA GAGAIKTNTF        60
     GANKISLECD FDVMKEAIVS GYEIAKEATE GTDVLVFADI GPIPFLEKVD LWVGYKEIID       120
     IFLSLGASNF IFETFSSDEY LIEISEYIKE KNSKAFILTE FAVSPEGVTR LGKSGKKLLN       180
     TMLKAKTIDA CGFNCFSGPY HLLQYSKTLD IKDKTISMMP NSGYPSMINN RVFFDNTKEY       240
     FAEQMLEIAR QGVTILGGCC GTTPEYIKEM VDKLKGLEVH NILNDGRQIE TTEGLKQEKL       300
     QEKKALTEEV KDEKRVNKNP LLEKLERGEK IIAVELDPPI NTEIDFFISG AKRLKGQGID       360
     AITIADCPIA RARVDSSLLA CKLKRELDIT AIPHMTCRDR NINATKALLL GLNVEGINNV       420
     LVVTGDPIPS ADREEIKGVF SFNSSILSSY IRELNETTFS SPFNVCGALN LNVRNFSNEL       480
     EKAQKKIDNG ITMFLTQPVL TEEAMENLKL ARKKLNAKIL GGIIPVVSYR NACFMNNEIS       540
     GINVSEEIIE RYKDVSKEEA TRLAVEISTG IATEMSSYVD GFYIITPFKR IDIVSEIVSN       600
     IKNNIFTYN                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page